| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
| Protein Succinate dehydogenase [81669] (3 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries) |
| Domain d2wqyb2: 2wqy B:115-246 [244219] Other proteins in same PDB: d2wqyb1, d2wqyc_, d2wqyd_, d2wqyo1, d2wqyp_, d2wqyq_ automated match to d1yq3b2 complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, oaa, pee, sf4, unl |
PDB Entry: 2wqy (more details), 2.1 Å
SCOPe Domain Sequences for d2wqyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wqyb2 a.1.2.1 (B:115-246) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyk
Timeline for d2wqyb2: