SCOPe 2.08: Domain d2wqrb3: 2wqr B:439-546

Lineage for d2wqrb3 (2wqr B:439-546)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2wqrb3: 2wqr B:439-546 [244217]
   automated match to d1o0va3
   complexed with gol, pg4, so4, trs

Details for d2wqrb3

PDB Entry: 2wqr, 1.9 Å

PDB Description: the high resolution crystal structure of ige fc

PDB Compounds: (B:) ig epsilon chain c region

SCOPe Domain Sequences for d2wqrb3:

Sequence; same for both SEQRES and ATOM records:

>d2wqrb3 b.1.1.0 (B:439-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnpg

Timeline for d2wqrb3:

• d2wqrb3 first appeared in SCOPe 2.04
  
• d2wqrb3 appears in SCOPe 2.07