SCOPe 2.07: Domain d2wqra3: 2wqr A:439-545

Lineage for d2wqra3 (2wqr A:439-545)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2wqra3: 2wqr A:439-545 [244214]
   automated match to d1o0va3
   complexed with bma, gol, man, nag, pg4, so4, trs

Details for d2wqra3

PDB Entry: 2wqr, 1.9 Å

PDB Description: the high resolution crystal structure of ige fc

PDB Compounds: (A:) ig epsilon chain c region

SCOPe Domain Sequences for d2wqra3:

Sequence; same for both SEQRES and ATOM records:

>d2wqra3 b.1.1.0 (A:439-545) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

Timeline for d2wqra3:

• d2wqra3 first appeared in SCOPe 2.04
  
• d2wqra3 appears in SCOPe 2.06
  
• d2wqra3 appears in the current release, SCOPe 2.08