Lineage for d2wqra1 (2wqr A:228-330)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765343Domain d2wqra1: 2wqr A:228-330 [244212]
    automated match to d1o0va1
    complexed with gol, pg4, so4, trs

Details for d2wqra1

PDB Entry: 2wqr (more details), 1.9 Å

PDB Description: the high resolution crystal structure of ige fc
PDB Compounds: (A:) ig epsilon chain c region

SCOPe Domain Sequences for d2wqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqra1 b.1.1.0 (A:228-330) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcad

SCOPe Domain Coordinates for d2wqra1:

Click to download the PDB-style file with coordinates for d2wqra1.
(The format of our PDB-style files is described here.)

Timeline for d2wqra1: