Lineage for d1a2vf1 (1a2v F:237-672)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782205Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1782206Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1782207Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1782313Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (4 PDB entries)
  8. 1782331Domain d1a2vf1: 1a2v F:237-672 [24421]
    Other proteins in same PDB: d1a2va2, d1a2va3, d1a2vb2, d1a2vb3, d1a2vc2, d1a2vc3, d1a2vd2, d1a2vd3, d1a2ve2, d1a2ve3, d1a2vf2, d1a2vf3
    complexed with cu

Details for d1a2vf1

PDB Entry: 1a2v (more details), 2.4 Å

PDB Description: copper amine oxidase from hansenula polymorpha
PDB Compounds: (F:) methylamine oxidase

SCOPe Domain Sequences for d1a2vf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2vf1 b.30.2.1 (F:237-672) Copper amine oxidase, domain 3 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri
slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp
itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqd
gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa
acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg
kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr
gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld
iqpsyamttseakrav

SCOPe Domain Coordinates for d1a2vf1:

Click to download the PDB-style file with coordinates for d1a2vf1.
(The format of our PDB-style files is described here.)

Timeline for d1a2vf1: