| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (55 species) not a true protein |
| Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255147] (2 PDB entries) |
| Domain d2wq8a3: 2wq8 A:538-639 [244209] Other proteins in same PDB: d2wq8a1, d2wq8a2 automated match to d1gofa1 complexed with acy, ca, cu, edo, gol |
PDB Entry: 2wq8 (more details), 2.19 Å
SCOPe Domain Sequences for d2wq8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wq8a3 b.1.18.0 (A:538-639) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
Timeline for d2wq8a3: