Lineage for d2wq8a2 (2wq8 A:151-537)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808720Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) (S)
  5. 2808721Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)
  6. 2808737Protein automated matches [254521] (1 species)
    not a true protein
  7. 2808738Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255146] (5 PDB entries)
  8. 2808743Domain d2wq8a2: 2wq8 A:151-537 [244208]
    Other proteins in same PDB: d2wq8a1, d2wq8a3
    automated match to d1gofa3
    complexed with acy, ca, cu, edo, gol

Details for d2wq8a2

PDB Entry: 2wq8 (more details), 2.19 Å

PDB Description: glycan labelling using engineered variants of galactose oxidase obtained by directed evolution
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2wq8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wq8a2 b.69.1.1 (A:151-537) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafegspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggsfsggvfekngevyspssktwtslpnakvnpmltadkqglyk
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdytdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgiifedstpvftpeiyvpeqdtfykqnpnsivrayhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylydsn

SCOPe Domain Coordinates for d2wq8a2:

Click to download the PDB-style file with coordinates for d2wq8a2.
(The format of our PDB-style files is described here.)

Timeline for d2wq8a2: