Lineage for d2wq8a1 (2wq8 A:1-150)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775232Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255145] (5 PDB entries)
  8. 2775237Domain d2wq8a1: 2wq8 A:1-150 [244207]
    Other proteins in same PDB: d2wq8a2, d2wq8a3
    automated match to d1gofa2
    complexed with acy, ca, cu, edo, gol

Details for d2wq8a1

PDB Entry: 2wq8 (more details), 2.19 Å

PDB Description: glycan labelling using engineered variants of galactose oxidase obtained by directed evolution
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2wq8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wq8a1 b.18.1.0 (A:1-150) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
asapigsaiprnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsvlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOPe Domain Coordinates for d2wq8a1:

Click to download the PDB-style file with coordinates for d2wq8a1.
(The format of our PDB-style files is described here.)

Timeline for d2wq8a1: