SCOPe 2.07: Domain d2wq7a2: 2wq7 A:216-509

Lineage for d2wq7a2 (2wq7 A:216-509)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
   multihelical; consists of two all-alpha subdomains

4. Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families)
   automatically mapped to Pfam PF03441

5. Family a.99.1.0: automated matches [231382] (1 protein)
   not a true family

6. Protein automated matches [231383] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231384] (6 PDB entries)

8. Domain d2wq7a2: 2wq7 A:216-509 [244206]
   Other proteins in same PDB: d2wq7a1
   automated match to d2wb2a2
   protein/DNA complex; complexed with fad

Details for d2wq7a2

PDB Entry: 2wq7, 2 Å

PDB Description: structure of the 6-4 photolyase of d. melanogaster in complex with the non-natural n4-methyl t(6-4)c lesion

PDB Compounds: (A:) RE11660p

SCOPe Domain Sequences for d2wq7a2:

Sequence; same for both SEQRES and ATOM records:

>d2wq7a2 a.99.1.0 (A:216-509) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gpnkfpggetealrrmeeslkdeiwvarfekpntapnslepsttvlspylkfgclsarlf
nqklkeiikrqpkhsqppvsligqlmwrefyytvaaaepnfdrmlgnvycmqipwqehpd
hleawthgrtgypfidaimrqlrqegwihhlarhavacfltrgdlwisweegqrvfeqll
ldqdwalnagnwmwlsasaffhqyfrvyspvafgkktdpqghyirkyvpelskypagciy
epwkaslvdqraygcvlgtdyphrivkhevvhkenikrmgaaykvnrevrtgke

Timeline for d2wq7a2:

• d2wq7a2 first appeared in SCOPe 2.04
  
• d2wq7a2 appears in SCOPe 2.06
  
• d2wq7a2 appears in the current release, SCOPe 2.08