Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) |
Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
Protein automated matches [226956] (5 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255655] (1 PDB entry) |
Domain d2wp8b2: 2wp8 B:153-239 [244202] Other proteins in same PDB: d2wp8b1 automated match to d2nn6b2 complexed with cl, gol |
PDB Entry: 2wp8 (more details), 3 Å
SCOPe Domain Sequences for d2wp8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wp8b2 d.101.1.0 (B:153-239) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} smfdyisgisvglydttplldtnsleenamstvtlgvvgkseklslllvedkipldrlen vlaigiagahrvrdlmdeelrkhaqkr
Timeline for d2wp8b2: