Lineage for d2wp8b2 (2wp8 B:153-239)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208270Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2208271Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2208423Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 2208424Protein automated matches [226956] (5 species)
    not a true protein
  7. 2208425Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255655] (1 PDB entry)
  8. 2208426Domain d2wp8b2: 2wp8 B:153-239 [244202]
    Other proteins in same PDB: d2wp8b1
    automated match to d2nn6b2
    complexed with cl, gol

Details for d2wp8b2

PDB Entry: 2wp8 (more details), 3 Å

PDB Description: yeast rrp44 nuclease
PDB Compounds: (B:) exosome complex component ski6

SCOPe Domain Sequences for d2wp8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wp8b2 d.101.1.0 (B:153-239) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
smfdyisgisvglydttplldtnsleenamstvtlgvvgkseklslllvedkipldrlen
vlaigiagahrvrdlmdeelrkhaqkr

SCOPe Domain Coordinates for d2wp8b2:

Click to download the PDB-style file with coordinates for d2wp8b2.
(The format of our PDB-style files is described here.)

Timeline for d2wp8b2: