Lineage for d1a2vd1 (1a2v D:237-672)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1534929Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1534930Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1534931Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1535037Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (4 PDB entries)
  8. 1535053Domain d1a2vd1: 1a2v D:237-672 [24419]
    Other proteins in same PDB: d1a2va2, d1a2va3, d1a2vb2, d1a2vb3, d1a2vc2, d1a2vc3, d1a2vd2, d1a2vd3, d1a2ve2, d1a2ve3, d1a2vf2, d1a2vf3
    complexed with cu

Details for d1a2vd1

PDB Entry: 1a2v (more details), 2.4 Å

PDB Description: copper amine oxidase from hansenula polymorpha
PDB Compounds: (D:) methylamine oxidase

SCOPe Domain Sequences for d1a2vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2vd1 b.30.2.1 (D:237-672) Copper amine oxidase, domain 3 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri
slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp
itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqd
gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa
acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg
kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr
gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld
iqpsyamttseakrav

SCOPe Domain Coordinates for d1a2vd1:

Click to download the PDB-style file with coordinates for d1a2vd1.
(The format of our PDB-style files is described here.)

Timeline for d1a2vd1: