Lineage for d1a2vd1 (1a2v D:237-672)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12903Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 12952Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 12953Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 12954Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 12981Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (2 PDB entries)
  8. 12988Domain d1a2vd1: 1a2v D:237-672 [24419]
    Other proteins in same PDB: d1a2va2, d1a2va3, d1a2vb2, d1a2vb3, d1a2vc2, d1a2vc3, d1a2vd2, d1a2vd3, d1a2ve2, d1a2ve3, d1a2vf2, d1a2vf3

Details for d1a2vd1

PDB Entry: 1a2v (more details), 2.4 Å

PDB Description: copper amine oxidase from hansenula polymorpha
PDB Compounds: (D:)

SCOP Domain Sequences for d1a2vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2vd1 b.30.2.1 (D:237-672) Copper amine oxidase, domain 3 (catalytic) {Yeast (Hansenula polymorpha)}
peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri
slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp
itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanaeyclywvfmqd
gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa
acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg
kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr
gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld
iqpsyamttseakrav

SCOP Domain Coordinates for d1a2vd1:

Click to download the PDB-style file with coordinates for d1a2vd1.
(The format of our PDB-style files is described here.)

Timeline for d1a2vd1: