Lineage for d2wncd1 (2wnc D:1-210)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (5 species)
    not a true protein
  7. 2408526Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (60 PDB entries)
  8. 2408575Domain d2wncd1: 2wnc D:1-210 [244184]
    Other proteins in same PDB: d2wnca2, d2wncb2, d2wncc2, d2wncd2, d2wnce2
    automated match to d2c9ta_
    complexed with tkt

Details for d2wncd1

PDB Entry: 2wnc (more details), 2.2 Å

PDB Description: crystal structure of aplysia achbp in complex with tropisetron
PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2wncd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wncd1 b.96.1.0 (D:1-210) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerrag

SCOPe Domain Coordinates for d2wncd1:

Click to download the PDB-style file with coordinates for d2wncd1.
(The format of our PDB-style files is described here.)

Timeline for d2wncd1: