SCOPe 2.08: Domain d2wncd1: 2wnc D:1-210

Lineage for d2wncd1 (2wnc D:1-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d2wncd1: 2wnc D:1-210 [244184]
   Other proteins in same PDB: d2wnca2, d2wncb2, d2wncc2, d2wncd2, d2wnce2
   automated match to d2c9ta_
   complexed with tkt

Details for d2wncd1

PDB Entry: 2wnc, 2.2 Å

PDB Description: crystal structure of aplysia achbp in complex with tropisetron

PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2wncd1:

Sequence; same for both SEQRES and ATOM records:

>d2wncd1 b.96.1.0 (D:1-210) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerrag

Timeline for d2wncd1:

• d2wncd1 first appeared in SCOPe 2.04, called d2wncd_
  
• d2wncd1 appears in SCOPe 2.07