SCOPe 2.05: Domain d2wn9e_: 2wn9 E:

Lineage for d2wn9e_ (2wn9 E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)

8. Domain d2wn9e_: 2wn9 E: [244180]
   automated match to d2c9ta_
   complexed with nag, zy5

Details for d2wn9e_

PDB Entry: 2wn9, 1.75 Å

PDB Description: crystal structure of aplysia achbp in complex with 4-0h-dmxba

PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2wn9e_:

Sequence, based on SEQRES records:

>d2wn9e_ b.96.1.0 (E:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
skyeilsatqtrqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records):

>d2wn9e_ b.96.1.0 (E:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dykddddklhsqanlmrlksdlfnrsypgptkddpltvtlgftlqdivkadsstnevdlv
yyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdg
svmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyassk
yeilsatqtrqvqhysccpepyidvnlvvkfrer

Timeline for d2wn9e_:

• d2wn9e_ first appeared in SCOPe 2.04
  
• d2wn9e_ is called d2wn9e1 in SCOPe 2.06
  
• d2wn9e_ appears in the current release, SCOPe 2.08, called d2wn9e1