SCOPe 2.08: Domain d2wn9c1: 2wn9 C:1-208

Lineage for d2wn9c1 (2wn9 C:1-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d2wn9c1: 2wn9 C:1-208 [244178]
   Other proteins in same PDB: d2wn9a2, d2wn9b2, d2wn9c2, d2wn9d2, d2wn9e2
   automated match to d2c9ta_
   complexed with nag, zy5

Details for d2wn9c1

PDB Entry: 2wn9, 1.75 Å

PDB Description: crystal structure of aplysia achbp in complex with 4-0h-dmxba

PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2wn9c1:

Sequence; same for both SEQRES and ATOM records:

>d2wn9c1 b.96.1.0 (C:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Timeline for d2wn9c1:

• d2wn9c1 first appeared in SCOPe 2.04, called d2wn9c_
  
• d2wn9c1 appears in SCOPe 2.07