Lineage for d2wm4a_ (2wm4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005739Species Mycobacterium tuberculosis [TaxId:83332] [226004] (12 PDB entries)
  8. 2005753Domain d2wm4a_: 2wm4 A: [244174]
    automated match to d4c9lb_
    complexed with ca, hem, vgj

Details for d2wm4a_

PDB Entry: 2wm4 (more details), 2.11 Å

PDB Description: x-ray structure of mycobacterium tuberculosis cytochrome p450 cyp124 in complex with phytanic acid
PDB Compounds: (A:) putative cytochrome p450 124

SCOPe Domain Sequences for d2wm4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wm4a_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
lntaiatrvngtpppevpiadielgsldfwaldddvrdgafatlrreapisfwptielpg
fvagnghwaltkyddvfyasrhpdifssypnitindqtpelaeyfgsmivlddprhqrlr
sivsraftpkvvarieaavrdrahrlvssmiannpdrqadlvselagplplqiicdmmgi
pkadhqrifhwtnvilgfgdpdlatdfdefmqvsadigayatalaedrrvnhhddltssl
veaevdgerlssreiasffillvvagnettrnaithgvlalsrypeqrdrwwsdfdglap
taveeivrwaspvvymrrtltqdielrgtkmaagdkvslwycsanrdeskfadpwtfdla
rnpnphlgfggggahfclganlarreirvafdelrrqmpdvvateeparllsqfihgikt
lpvtws

SCOPe Domain Coordinates for d2wm4a_:

Click to download the PDB-style file with coordinates for d2wm4a_.
(The format of our PDB-style files is described here.)

Timeline for d2wm4a_: