![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
![]() | Protein automated matches [190782] (2 species) not a true protein |
![]() | Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (4 PDB entries) |
![]() | Domain d2wlib2: 2wli B:139-295 [244173] Other proteins in same PDB: d2wlia1, d2wlia3, d2wlib1, d2wlib3 automated match to d2wlka2 complexed with k |
PDB Entry: 2wli (more details), 3.09 Å
SCOPe Domain Sequences for d2wlib2:
Sequence, based on SEQRES records: (download)
>d2wlib2 b.1.18.16 (B:139-295) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaq
>d2wlib2 b.1.18.16 (B:139-295) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrserrfhdltltrsrsp ifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharhayscdeii wgghfvdvfttlpdgrraldlgkfheiaq
Timeline for d2wlib2: