SCOPe 2.08: Domain d2wlib2: 2wli B:139-295

Lineage for d2wlib2 (2wli B:139-295)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein automated matches [190782] (2 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (5 PDB entries)

8. Domain d2wlib2: 2wli B:139-295 [244173]
   Other proteins in same PDB: d2wlia1, d2wlia3, d2wlib1, d2wlib3
   automated match to d2wlka2
   complexed with k

Details for d2wlib2

PDB Entry: 2wli, 3.09 Å

PDB Description: potassium channel from magnetospirillum magnetotacticum

PDB Compounds: (B:) kirbac3.1 potassium channel

SCOPe Domain Sequences for d2wlib2:

Sequence, based on SEQRES records:

>d2wlib2 b.1.18.16 (B:139-295) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaq

Sequence, based on observed residues (ATOM records):

>d2wlib2 b.1.18.16 (B:139-295) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrserrfhdltltrsrsp
ifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharhayscdeii
wgghfvdvfttlpdgrraldlgkfheiaq

Timeline for d2wlib2:

• d2wlib2 first appeared in SCOPe 2.04
  
• d2wlib2 appears in SCOPe 2.07