SCOPe 2.04: Domain d2wlia2: 2wli A:139-299

Lineage for d2wlia2 (2wli A:139-299)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein automated matches [190782] (2 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (4 PDB entries)

8. Domain d2wlia2: 2wli A:139-299 [244171]
   Other proteins in same PDB: d2wlia1, d2wlib1
   automated match to d2wlka2
   complexed with k

Details for d2wlia2

PDB Entry: 2wli, 3.09 Å

PDB Description: potassium channel from magnetospirillum magnetotacticum

PDB Compounds: (A:) potassium channel

SCOPe Domain Sequences for d2wlia2:

Sequence; same for both SEQRES and ATOM records:

>d2wlia2 b.1.18.16 (A:139-299) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
trtrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh

Timeline for d2wlia2:

• d2wlia2 is new in SCOPe 2.04-stable
  
• d2wlia2 appears in SCOPe 2.05
  
• d2wlia2 appears in the current release, SCOPe 2.08