![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein automated matches [190184] (3 species) not a true protein |
![]() | Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (4 PDB entries) |
![]() | Domain d2wlia1: 2wli A:12-138 [244170] Other proteins in same PDB: d2wlia2, d2wlia3, d2wlib2, d2wlib3 automated match to d2wlka1 complexed with k |
PDB Entry: 2wli (more details), 3.09 Å
SCOPe Domain Sequences for d2wlia1:
Sequence, based on SEQRES records: (download)
>d2wlia1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} prilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylac gdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasli yarftrp
>d2wlia1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} prilnsdgssnitrlgllddhyhdlltvswpvfitlitglylvtnalfalaylacgdvie narpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarft rp
Timeline for d2wlia1: