Lineage for d2wlia1 (2wli A:12-138)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023599Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 3023715Protein automated matches [190184] (3 species)
    not a true protein
  7. 3023718Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (5 PDB entries)
  8. 3023723Domain d2wlia1: 2wli A:12-138 [244170]
    Other proteins in same PDB: d2wlia2, d2wlia3, d2wlib2, d2wlib3
    automated match to d2wlka1
    complexed with k

Details for d2wlia1

PDB Entry: 2wli (more details), 3.09 Å

PDB Description: potassium channel from magnetospirillum magnetotacticum
PDB Compounds: (A:) potassium channel

SCOPe Domain Sequences for d2wlia1:

Sequence, based on SEQRES records: (download)

>d2wlia1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylac
gdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasli
yarftrp

Sequence, based on observed residues (ATOM records): (download)

>d2wlia1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlgllddhyhdlltvswpvfitlitglylvtnalfalaylacgdvie
narpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarft
rp

SCOPe Domain Coordinates for d2wlia1:

Click to download the PDB-style file with coordinates for d2wlia1.
(The format of our PDB-style files is described here.)

Timeline for d2wlia1: