SCOPe 2.07: Domain d2wk6b3: 2wk6 B:374-481

Lineage for d2wk6b3 (2wk6 B:374-481)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families)

5. Family d.41.3.0: automated matches [254277] (1 protein)
   not a true family

6. Protein automated matches [254643] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255654] (2 PDB entries)

8. Domain d2wk6b3: 2wk6 B:374-481 [244169]
   Other proteins in same PDB: d2wk6a1, d2wk6a2, d2wk6b1, d2wk6b2
   automated match to d1uoua3
   complexed with iur

Details for d2wk6b3

PDB Entry: 2wk6, 2.5 Å

PDB Description: structural features of native human thymidine phosphorylase and in complex with 5-iodouracil

PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d2wk6b3:

Sequence; same for both SEQRES and ATOM records:

>d2wk6b3 d.41.3.0 (B:374-481) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rareqeellapadgtvelvralplalvlhelgagrsrageplrlgvgaellvdvgqrlrr
gtpwlrvhrdgpalsgpqsralqealvlsdrapfaapspfaelvlppq

Timeline for d2wk6b3:

• d2wk6b3 first appeared in SCOPe 2.04
  
• d2wk6b3 appears in SCOPe 2.06
  
• d2wk6b3 appears in the current release, SCOPe 2.08