Lineage for d2wk6b1 (2wk6 B:35-100)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714352Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2714363Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2714423Family a.46.2.0: automated matches [254276] (1 protein)
    not a true family
  6. 2714424Protein automated matches [254641] (6 species)
    not a true protein
  7. 2714430Species Human (Homo sapiens) [TaxId:9606] [255652] (2 PDB entries)
  8. 2714432Domain d2wk6b1: 2wk6 B:35-100 [244167]
    Other proteins in same PDB: d2wk6a2, d2wk6a3, d2wk6b2, d2wk6b3
    automated match to d1uoua1
    complexed with iur

Details for d2wk6b1

PDB Entry: 2wk6 (more details), 2.5 Å

PDB Description: structural features of native human thymidine phosphorylase and in complex with 5-iodouracil
PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d2wk6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wk6b1 a.46.2.0 (B:35-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvltqa
laqsgq

SCOPe Domain Coordinates for d2wk6b1:

Click to download the PDB-style file with coordinates for d2wk6b1.
(The format of our PDB-style files is described here.)

Timeline for d2wk6b1: