Lineage for d2wk6a2 (2wk6 A:101-373)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2469961Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2469962Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2469963Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)
  6. 2470022Protein automated matches [254642] (3 species)
    not a true protein
  7. 2470023Species Human (Homo sapiens) [TaxId:9606] [255653] (2 PDB entries)
  8. 2470024Domain d2wk6a2: 2wk6 A:101-373 [244165]
    Other proteins in same PDB: d2wk6a1, d2wk6a3, d2wk6b1, d2wk6b3
    automated match to d1uoua2
    complexed with iur

Details for d2wk6a2

PDB Entry: 2wk6 (more details), 2.5 Å

PDB Description: structural features of native human thymidine phosphorylase and in complex with 5-iodouracil
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d2wk6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wk6a2 c.27.1.1 (A:101-373) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlewpeawrqqlvdkhstggvgdkvslvlapalaacgckvpmisgrglghtggtldkles
ipgfnviqspeqmqvlldqagccivgqseqlvpadgilyaardvtatvdslplitasils
kklveglsalvvdvkfggaavfpnqeqarelaktlvgvgaslglrvaaaltamdkplgrc
vghaleveeallcmdgagppdlrdlvttlggallwlsghagtqaqgaarvaaalddgsal
grfermlaaqgvdpglaralcsgspaerrqllp

SCOPe Domain Coordinates for d2wk6a2:

Click to download the PDB-style file with coordinates for d2wk6a2.
(The format of our PDB-style files is described here.)

Timeline for d2wk6a2: