Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) automatically mapped to Pfam PF00591 |
Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins) |
Protein automated matches [254642] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255653] (2 PDB entries) |
Domain d2wk6a2: 2wk6 A:101-373 [244165] Other proteins in same PDB: d2wk6a1, d2wk6a3, d2wk6b1, d2wk6b3 automated match to d1uoua2 complexed with iur |
PDB Entry: 2wk6 (more details), 2.5 Å
SCOPe Domain Sequences for d2wk6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wk6a2 c.27.1.1 (A:101-373) automated matches {Human (Homo sapiens) [TaxId: 9606]} qlewpeawrqqlvdkhstggvgdkvslvlapalaacgckvpmisgrglghtggtldkles ipgfnviqspeqmqvlldqagccivgqseqlvpadgilyaardvtatvdslplitasils kklveglsalvvdvkfggaavfpnqeqarelaktlvgvgaslglrvaaaltamdkplgrc vghaleveeallcmdgagppdlrdlvttlggallwlsghagtqaqgaarvaaalddgsal grfermlaaqgvdpglaralcsgspaerrqllp
Timeline for d2wk6a2: