SCOPe 2.04: Domain d2wk6a1: 2wk6 A:35-100

Lineage for d2wk6a1 (2wk6 A:35-100)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.0: automated matches [254276] (1 protein)
   not a true family

6. Protein automated matches [254641] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255652] (2 PDB entries)

8. Domain d2wk6a1: 2wk6 A:35-100 [244164]
   Other proteins in same PDB: d2wk6a2, d2wk6a3, d2wk6b2, d2wk6b3
   automated match to d1uoua1
   complexed with iur

Details for d2wk6a1

PDB Entry: 2wk6, 2.5 Å

PDB Description: structural features of native human thymidine phosphorylase and in complex with 5-iodouracil

PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d2wk6a1:

Sequence; same for both SEQRES and ATOM records:

>d2wk6a1 a.46.2.0 (A:35-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvltqa
laqsgq

Timeline for d2wk6a1:

• d2wk6a1 is new in SCOPe 2.04-stable
  
• d2wk6a1 appears in SCOPe 2.05
  
• d2wk6a1 appears in the current release, SCOPe 2.08