![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) ![]() automatically mapped to Pfam PF00591 |
![]() | Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins) |
![]() | Protein automated matches [254642] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255653] (2 PDB entries) |
![]() | Domain d2wk5c2: 2wk5 C:101-373 [244159] Other proteins in same PDB: d2wk5a1, d2wk5a3, d2wk5b1, d2wk5b3, d2wk5c1, d2wk5c3, d2wk5d1, d2wk5d3 automated match to d1uoua2 complexed with gol |
PDB Entry: 2wk5 (more details), 2.99 Å
SCOPe Domain Sequences for d2wk5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wk5c2 c.27.1.1 (C:101-373) automated matches {Human (Homo sapiens) [TaxId: 9606]} qlewpeawrqqlvdkhstggvgdkvslvlapalaacgckvpmisgrglghtggtldkles ipgfnviqspeqmqvlldqagccivgqseqlvpadgilyaardvtatvdslplitasils kklveglsalvvdvkfggaavfpnqeqarelaktlvgvgaslglrvaaaltamdkplgrc vghaleveeallcmdgagppdlrdlvttlggallwlsghagtqaqgaarvaaalddgsal grfermlaaqgvdpglaralcsgspaerrqllp
Timeline for d2wk5c2: