Class a: All alpha proteins [46456] (285 folds) |
Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) automatically mapped to Pfam PF02885 |
Family a.46.2.0: automated matches [254276] (1 protein) not a true family |
Protein automated matches [254641] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255652] (2 PDB entries) |
Domain d2wk5c1: 2wk5 C:33-100 [244158] Other proteins in same PDB: d2wk5a2, d2wk5a3, d2wk5b2, d2wk5b3, d2wk5c2, d2wk5c3, d2wk5d2, d2wk5d3 automated match to d1uoua1 complexed with gol |
PDB Entry: 2wk5 (more details), 2.99 Å
SCOPe Domain Sequences for d2wk5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wk5c1 a.46.2.0 (C:33-100) automated matches {Human (Homo sapiens) [TaxId: 9606]} pkqlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvlt qalaqsgq
Timeline for d2wk5c1: