Lineage for d2wk5b3 (2wk5 B:374-481)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945237Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2945255Family d.41.3.0: automated matches [254277] (1 protein)
    not a true family
  6. 2945256Protein automated matches [254643] (6 species)
    not a true protein
  7. 2945262Species Human (Homo sapiens) [TaxId:9606] [255654] (2 PDB entries)
  8. 2945266Domain d2wk5b3: 2wk5 B:374-481 [244157]
    Other proteins in same PDB: d2wk5a1, d2wk5a2, d2wk5b1, d2wk5b2, d2wk5c1, d2wk5c2, d2wk5d1, d2wk5d2
    automated match to d1uoua3
    complexed with gol

Details for d2wk5b3

PDB Entry: 2wk5 (more details), 2.99 Å

PDB Description: structural features of native human thymidine phosphorylase and in complex with 5-iodouracil
PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d2wk5b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wk5b3 d.41.3.0 (B:374-481) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rareqeellapadgtvelvralplalvlhelgagrsrageplrlgvgaellvdvgqrlrr
gtpwlrvhrdgpalsgpqsralqealvlsdrapfaapspfaelvlppq

SCOPe Domain Coordinates for d2wk5b3:

Click to download the PDB-style file with coordinates for d2wk5b3.
(The format of our PDB-style files is described here.)

Timeline for d2wk5b3: