Lineage for d2wk5b1 (2wk5 B:32-100)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1492652Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 1492663Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 1492719Family a.46.2.0: automated matches [254276] (1 protein)
    not a true family
  6. 1492720Protein automated matches [254641] (2 species)
    not a true protein
  7. 1492721Species Human (Homo sapiens) [TaxId:9606] [255652] (2 PDB entries)
  8. 1492725Domain d2wk5b1: 2wk5 B:32-100 [244155]
    Other proteins in same PDB: d2wk5a2, d2wk5a3, d2wk5b2, d2wk5b3, d2wk5c2, d2wk5c3, d2wk5d2, d2wk5d3
    automated match to d1uoua1
    complexed with gol

Details for d2wk5b1

PDB Entry: 2wk5 (more details), 2.99 Å

PDB Description: structural features of native human thymidine phosphorylase and in complex with 5-iodouracil
PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d2wk5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wk5b1 a.46.2.0 (B:32-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epkqlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvl
tqalaqsgq

SCOPe Domain Coordinates for d2wk5b1:

Click to download the PDB-style file with coordinates for d2wk5b1.
(The format of our PDB-style files is described here.)

Timeline for d2wk5b1: