Lineage for d2wjpa2 (2wjp A:94-297)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904995Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2904996Family c.72.2.1: MurCDEF [53624] (5 proteins)
    automatically mapped to Pfam PF08245
  6. 2905026Protein automated matches [254549] (3 species)
    not a true protein
  7. 2905036Species Escherichia coli [TaxId:668369] [255650] (2 PDB entries)
  8. 2905037Domain d2wjpa2: 2wjp A:94-297 [244148]
    Other proteins in same PDB: d2wjpa1, d2wjpa3, d2wjpa4
    automated match to d4uaga3
    complexed with azi, cl, d17, dms, so4

Details for d2wjpa2

PDB Entry: 2wjp (more details), 1.6 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing rhodanine inhibitor
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2wjpa2:

Sequence, based on SEQRES records: (download)

>d2wjpa2 c.72.2.1 (A:94-297) automated matches {Escherichia coli [TaxId: 668369]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Sequence, based on observed residues (ATOM records): (download)

>d2wjpa2 c.72.2.1 (A:94-297) automated matches {Escherichia coli [TaxId: 668369]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirrcvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnalaala
ladaaglprasslkalttft

SCOPe Domain Coordinates for d2wjpa2:

Click to download the PDB-style file with coordinates for d2wjpa2.
(The format of our PDB-style files is described here.)

Timeline for d2wjpa2: