![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
![]() | Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) ![]() |
![]() | Family c.5.1.0: automated matches [254240] (1 protein) not a true family |
![]() | Protein automated matches [254548] (5 species) not a true protein |
![]() | Species Escherichia coli [TaxId:668369] [255649] (2 PDB entries) |
![]() | Domain d2wjpa1: 2wjp A:1-93 [244147] Other proteins in same PDB: d2wjpa2, d2wjpa3, d2wjpa4 automated match to d4uaga1 complexed with azi, cl, d17, dms, so4 |
PDB Entry: 2wjp (more details), 1.6 Å
SCOPe Domain Sequences for d2wjpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wjpa1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 668369]} adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde wlmaadlivaspgialahpslsaaadagieivg
Timeline for d2wjpa1: