Class a: All alpha proteins [46456] (286 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (45 species) not a true protein |
Species Saccharopolyspora erythraea [TaxId:1836] [225746] (5 PDB entries) |
Domain d2wioa_: 2wio A: [244146] automated match to d2jjpa_ complexed with hem |
PDB Entry: 2wio (more details), 2 Å
SCOPe Domain Sequences for d2wioa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wioa_ a.104.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]} devpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdptrvie gasptpgmiheidppehralrkvvssaftprtisdleprirdvtrslladagesfdlvdv lafplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnpltaylk arcaerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgnivrtld ehpahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvntwvls anrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarfgrlt vdrdderlrhfeqivlgtrhlpvlagssprqsa
Timeline for d2wioa_: