Lineage for d2wioa_ (2wio A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005860Species Saccharopolyspora erythraea [TaxId:1836] [225746] (6 PDB entries)
  8. 2005863Domain d2wioa_: 2wio A: [244146]
    automated match to d2jjpa_
    complexed with hem

Details for d2wioa_

PDB Entry: 2wio (more details), 2 Å

PDB Description: structure of the histidine tagged, open cytochrome p450 eryk from s. erythraea
PDB Compounds: (A:) erythromycin b/d c-12 hydroxylase

SCOPe Domain Sequences for d2wioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wioa_ a.104.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]}
devpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdptrvie
gasptpgmiheidppehralrkvvssaftprtisdleprirdvtrslladagesfdlvdv
lafplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnpltaylk
arcaerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgnivrtld
ehpahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvntwvls
anrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarfgrlt
vdrdderlrhfeqivlgtrhlpvlagssprqsa

SCOPe Domain Coordinates for d2wioa_:

Click to download the PDB-style file with coordinates for d2wioa_.
(The format of our PDB-style files is described here.)

Timeline for d2wioa_: