Lineage for d2whwa_ (2whw A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1499255Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1499256Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1499814Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1499815Protein automated matches [190847] (40 species)
    not a true protein
  7. 1500156Species Streptomyces venezuelae [TaxId:54571] [255065] (11 PDB entries)
  8. 1500166Domain d2whwa_: 2whw A: [244140]
    automated match to d4dnja_
    complexed with 1d4, hem, so4

Details for d2whwa_

PDB Entry: 2whw (more details), 2.2 Å

PDB Description: selective oxidation of carbolide c-h bonds by engineered macrolide p450 monooxygenase
PDB Compounds: (A:) cytochrome p450 monooxygenase

SCOPe Domain Sequences for d2whwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2whwa_ a.104.1.0 (A:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
ppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprfs
kdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdglv
damlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqtam
aemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvnl
iangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvipa
gdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavral
lercpdlaldvspgelvwypnpmirglkalpirwrr

SCOPe Domain Coordinates for d2whwa_:

Click to download the PDB-style file with coordinates for d2whwa_.
(The format of our PDB-style files is described here.)

Timeline for d2whwa_: