Lineage for d1ekmb1 (1ekm B:237-672)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12903Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 12952Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 12953Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 12954Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 12981Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (2 PDB entries)
  8. 12983Domain d1ekmb1: 1ekm B:237-672 [24414]
    Other proteins in same PDB: d1ekma2, d1ekma3, d1ekmb2, d1ekmb3, d1ekmc2, d1ekmc3

Details for d1ekmb1

PDB Entry: 1ekm (more details), 2.5 Å

PDB Description: crystal structure at 2.5 a resolution of zinc-substituted copper amine oxidase of hansenula polymorpha expressed in escherichia coli
PDB Compounds: (B:)

SCOP Domain Sequences for d1ekmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekmb1 b.30.2.1 (B:237-672) Copper amine oxidase, domain 3 (catalytic) {Yeast (Hansenula polymorpha)}
peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri
slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp
itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqd
gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa
acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg
kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr
gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld
iqpsyamttseakrav

SCOP Domain Coordinates for d1ekmb1:

Click to download the PDB-style file with coordinates for d1ekmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ekmb1: