![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [196910] (13 PDB entries) |
![]() | Domain d2wggh1: 2wgg H:2-259 [244137] automated match to d2wgfa1 complexed with 2pe, na, peg, tlm |
PDB Entry: 2wgg (more details), 2 Å
SCOPe Domain Sequences for d2wggh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wggh1 c.95.1.0 (H:2-259) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge agalmlieteehakarga
Timeline for d2wggh1: