Lineage for d1ekma1 (1ekm A:237-672)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309061Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1309062Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1309063Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1309064Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1309170Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (4 PDB entries)
  8. 1309189Domain d1ekma1: 1ekm A:237-672 [24413]
    Other proteins in same PDB: d1ekma2, d1ekma3, d1ekmb2, d1ekmb3, d1ekmc2, d1ekmc3
    complexed with zn

Details for d1ekma1

PDB Entry: 1ekm (more details), 2.5 Å

PDB Description: crystal structure at 2.5 a resolution of zinc-substituted copper amine oxidase of hansenula polymorpha expressed in escherichia coli
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1ekma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekma1 b.30.2.1 (A:237-672) Copper amine oxidase, domain 3 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri
slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp
itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqd
gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa
acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg
kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr
gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld
iqpsyamttseakrav

SCOPe Domain Coordinates for d1ekma1:

Click to download the PDB-style file with coordinates for d1ekma1.
(The format of our PDB-style files is described here.)

Timeline for d1ekma1: