Lineage for d2wg4a_ (2wg4 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563508Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2563509Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2563514Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 2563521Protein Sonic hedgehog [55171] (1 species)
  7. 2563522Species Mouse (Mus musculus) [TaxId:10090] [55172] (4 PDB entries)
  8. 2563527Domain d2wg4a_: 2wg4 A: [244122]
    automated match to d1vhha_
    complexed with na, zn

Details for d2wg4a_

PDB Entry: 2wg4 (more details), 3.15 Å

PDB Description: crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog without calcium
PDB Compounds: (A:) sonic hedgehog protein n-product

SCOPe Domain Sequences for d2wg4a_:

Sequence, based on SEQRES records: (download)

>d2wg4a_ d.65.1.2 (A:) Sonic hedgehog {Mouse (Mus musculus) [TaxId: 10090]}
ltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrlm
tqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsky
gmlarlaveagfdwvyyeskahihcsvkae

Sequence, based on observed residues (ATOM records): (download)

>d2wg4a_ d.65.1.2 (A:) Sonic hedgehog {Mouse (Mus musculus) [TaxId: 10090]}
ltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdadrlmtqrck
dklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrskygmlar
laveagfdwvyyeskahihcsvkae

SCOPe Domain Coordinates for d2wg4a_:

Click to download the PDB-style file with coordinates for d2wg4a_.
(The format of our PDB-style files is described here.)

Timeline for d2wg4a_: