SCOPe 2.08: Domain d2wc2b2: 2wc2 B:138-209

Lineage for d2wc2b2 (2wc2 B:138-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [255648] (1 PDB entry)

8. Domain d2wc2b2: 2wc2 B:138-209 [244115]
   Other proteins in same PDB: d2wc2a1, d2wc2b1
   automated match to d4i02a2

Details for d2wc2b2

PDB Entry: 2wc2

PDB Description: nmr structure of catabolite activator protein in the unliganded state

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d2wc2b2:

Sequence; same for both SEQRES and ATOM records:

>d2wc2b2 a.4.5.0 (B:138-209) automated matches {Escherichia coli [TaxId: 469008]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygtr

Timeline for d2wc2b2:

• d2wc2b2 first appeared in SCOPe 2.04
  
• d2wc2b2 appears in SCOPe 2.07