Lineage for d2wc2a2 (2wc2 A:138-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984327Species Escherichia coli [TaxId:469008] [255648] (1 PDB entry)
  8. 1984328Domain d2wc2a2: 2wc2 A:138-209 [244113]
    Other proteins in same PDB: d2wc2a1, d2wc2b1
    automated match to d4i02a2

Details for d2wc2a2

PDB Entry: 2wc2 (more details)

PDB Description: nmr structure of catabolite activator protein in the unliganded state
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d2wc2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wc2a2 a.4.5.0 (A:138-209) automated matches {Escherichia coli [TaxId: 469008]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygtr

SCOPe Domain Coordinates for d2wc2a2:

Click to download the PDB-style file with coordinates for d2wc2a2.
(The format of our PDB-style files is described here.)

Timeline for d2wc2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wc2a1