Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (68 species) not a true protein |
Species Escherichia coli [TaxId:469008] [255648] (1 PDB entry) |
Domain d2wc2a2: 2wc2 A:138-209 [244113] Other proteins in same PDB: d2wc2a1, d2wc2b1 automated match to d4i02a2 |
PDB Entry: 2wc2 (more details)
SCOPe Domain Sequences for d2wc2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wc2a2 a.4.5.0 (A:138-209) automated matches {Escherichia coli [TaxId: 469008]} dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis ahgktivvygtr
Timeline for d2wc2a2: