Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein automated matches [190352] (8 species) not a true protein |
Species Escherichia coli [TaxId:469008] [255647] (1 PDB entry) |
Domain d2wc2a1: 2wc2 A:1-137 [244112] Other proteins in same PDB: d2wc2a2, d2wc2b2 automated match to d4i02b1 |
PDB Entry: 2wc2 (more details)
SCOPe Domain Sequences for d2wc2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wc2a1 b.82.3.2 (A:1-137) automated matches {Escherichia coli [TaxId: 469008]} vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm arrlqvtsekvgnlafl
Timeline for d2wc2a1: