Lineage for d1av4_1 (1av4 212-628)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.30: Supersandwich [49993] (3 superfamilies)
sandwich; 18 strands in 2 sheets
Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) 
Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins) 
Protein Copper amine oxidase, domain 3 [50000] (4 species) Species Arthrobacter globiformis [TaxId:1665] [50003] (15 PDB entries) 
Domain d1av4_1: 1av4 212-628 [24411]
Other proteins in same PDB: d1av4_2, d1av4_3
complexed with cu
Details for d1av4_1
PDB Entry: 1av4 (more details), 2.2 Å
PDB Description: crystal structures of the copper-containing amine oxidase from arthrobacter globiformis in the holo-and apo-forms: implications for the biogenesis of topa quinone
SCOP Domain Sequences for d1av4_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1av4_1 b.30.2.1 (212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignadygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan
SCOP Domain Coordinates for d1av4_1:
Click to download the PDB-style file with coordinates for d1av4_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1av4_1:
- d1av4_1 first appeared (with stable ids) in SCOP 1.55
- d1av4_1 appears in SCOP 1.69
- d1av4_1 is called d1av4a1 in SCOP 1.73
- d1av4_1 appears in the current release, SCOPe 2.08, called d1av4a1
View in 3D
