Lineage for d2wbma3 (2wbm A:163-232)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953573Family d.58.11.0: automated matches [254210] (1 protein)
    not a true family
  6. 2953574Protein automated matches [254469] (4 species)
    not a true protein
  7. 2953605Species Methanothermobacter thermautotrophicus [TaxId:187420] [255646] (1 PDB entry)
  8. 2953606Domain d2wbma3: 2wbm A:163-232 [244108]
    Other proteins in same PDB: d2wbma1, d2wbma2, d2wbma4, d2wbmb1, d2wbmb2
    automated match to d1p9qc3
    complexed with cl, gol, so4

Details for d2wbma3

PDB Entry: 2wbm (more details), 1.75 Å

PDB Description: crystal structure of mthsbds, the homologue of the shwachman-bodian- diamond syndrome protein in the euriarchaeon methanothermobacter thermautotrophicus
PDB Compounds: (A:) ribosome maturation protein sdo1 homolog

SCOPe Domain Sequences for d2wbma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbma3 d.58.11.0 (A:163-232) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
ekvrvaikipgemagsaygvisnfgkitneewqndgswiavveipgglqdsfyqklselt
ggnvetrlik

SCOPe Domain Coordinates for d2wbma3:

Click to download the PDB-style file with coordinates for d2wbma3.
(The format of our PDB-style files is described here.)

Timeline for d2wbma3: