SCOPe 2.04: Domain d2wbma1: 2wbm A:-1-87

Lineage for d2wbma1 (2wbm A:-1-87)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.235: FYSH domain [89894] (1 superfamily)
   beta(2)-alpha(2)-beta(2)-alpha-beta; two layers: alpha/beta; antiparallel sheet: order 51234

4. Superfamily d.235.1: FYSH domain [89895] (3 families)

5. Family d.235.1.0: automated matches [254274] (1 protein)
   not a true family

6. Protein automated matches [254639] (1 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [255644] (1 PDB entry)

8. Domain d2wbma1: 2wbm A:-1-87 [244106]
   Other proteins in same PDB: d2wbma2, d2wbma3, d2wbmb2, d2wbmb3
   automated match to d1p9qc2
   complexed with cl, gol, so4

Details for d2wbma1

PDB Entry: 2wbm, 1.75 Å

PDB Description: crystal structure of mthsbds, the homologue of the shwachman-bodian- diamond syndrome protein in the euriarchaeon methanothermobacter thermautotrophicus

PDB Compounds: (A:) ribosome maturation protein sdo1 homolog

SCOPe Domain Sequences for d2wbma1:

Sequence; same for both SEQRES and ATOM records:

>d2wbma1 d.235.1.0 (A:-1-87) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
shmvsledaviarleshgerfevlvdpdlaaefrredsdvsvedvlavqevfrdarkgdk
aseeamrkvfetadplevtpvilrrgtiq

Timeline for d2wbma1:

• d2wbma1 is new in SCOPe 2.04-stable
  
• d2wbma1 appears in SCOPe 2.05
  
• d2wbma1 appears in the current release, SCOPe 2.08