Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries) |
Domain d2wbka1: 2wbk A:28-219 [244096] Other proteins in same PDB: d2wbka2, d2wbka3, d2wbka4, d2wbka5, d2wbkb2, d2wbkb3, d2wbkb4, d2wbkb5, d2wbkb6 automated match to d2je8a4 complexed with br, cl, edo, m2f |
PDB Entry: 2wbk (more details), 2.1 Å
SCOPe Domain Sequences for d2wbka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wbka1 b.18.1.0 (A:28-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts gvwrpvtlrfyd
Timeline for d2wbka1: