Lineage for d2wbje2 (2wbj E:82-180)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033957Domain d2wbje2: 2wbj E:82-180 [244091]
    Other proteins in same PDB: d2wbja1, d2wbjb1, d2wbjb2, d2wbjc2, d2wbje1, d2wbjf1, d2wbjf2, d2wbjg2
    automated match to d1ieaa1
    complexed with nag, so4

Details for d2wbje2

PDB Entry: 2wbj (more details), 3 Å

PDB Description: tcr complex
PDB Compounds: (E:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2wbje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbje2 b.1.1.0 (E:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOPe Domain Coordinates for d2wbje2:

Click to download the PDB-style file with coordinates for d2wbje2.
(The format of our PDB-style files is described here.)

Timeline for d2wbje2: