SCOPe 2.06: Domain d2wbjb2: 2wbj B:93-188

Lineage for d2wbjb2 (2wbj B:93-188)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d2wbjb2: 2wbj B:93-188 [244087]
   Other proteins in same PDB: d2wbja1, d2wbja2, d2wbjb1, d2wbjc1, d2wbje1, d2wbje2, d2wbjf1, d2wbjg1
   automated match to d1sebb1
   complexed with nag, so4

Details for d2wbjb2

PDB Entry: 2wbj, 3 Å

PDB Description: tcr complex

PDB Compounds: (B:) hla class II histocompatibility antigen, drb1-15 beta chain

SCOPe Domain Sequences for d2wbjb2:

Sequence, based on SEQRES records:

>d2wbjb2 b.1.1.2 (B:93-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvqpkvtvypsktqplqhhnllvcsvsgfypgsievrwflngqeekagmvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvew

Sequence, based on observed residues (ATOM records):

>d2wbjb2 b.1.1.2 (B:93-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvqpkvtvypsktqphhnllvcsvsgfypgsievrwflngqeekagmvstgliqngdwt
fqtlvmletvpytcqvehpsvtspltvew

Timeline for d2wbjb2:

• d2wbjb2 first appeared in SCOPe 2.04
  
• d2wbjb2 appears in SCOPe 2.05
  
• d2wbjb2 appears in SCOPe 2.07
  
• d2wbjb2 appears in the current release, SCOPe 2.08