SCOPe 2.04: Domain d2watc_: 2wat C:

Lineage for d2watc_ (2wat C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255643] (2 PDB entries)

8. Domain d2watc_: 2wat C: [244080]
   automated match to d3gwma_
   complexed with cl, coa, mg

Details for d2watc_

PDB Entry: 2wat, 2.2 Å

PDB Description: structure of the fungal type i fas ppt domain in complex with coa

PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d2watc_:

Sequence; same for both SEQRES and ATOM records:

>d2watc_ d.150.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ggvgvdvelitsinvendtfiernftpqeieycsaqpsvqssfagtwsakeavfkslgvk
slgggaalkdieivrvnknapavelhgnakkaaeeagvtdvkvsishddlqavavavstk

Timeline for d2watc_:

• d2watc_ is new in SCOPe 2.04-stable
  
• d2watc_ appears in SCOPe 2.05
  
• d2watc_ appears in the current release, SCOPe 2.08