Lineage for d2wasf_ (2was F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934100Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1934101Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1934134Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 1934135Protein automated matches [191061] (9 species)
    not a true protein
  7. 1934140Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255643] (2 PDB entries)
  8. 1934146Domain d2wasf_: 2was F: [244077]
    automated match to d3gwma_

Details for d2wasf_

PDB Entry: 2was (more details), 1.9 Å

PDB Description: structure of the fungal type i fas ppt domain
PDB Compounds: (F:) 3-oxoacyl-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d2wasf_:

Sequence, based on SEQRES records: (download)

>d2wasf_ d.150.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvgvdvelitsinvendtfiernftpqeieycsaqpsvqssfagtwsakeavfkslgvks
lgggaalkdieivrtnknapavelhgnakkaaeeagvtdvkvsishddlqavavavstk

Sequence, based on observed residues (ATOM records): (download)

>d2wasf_ d.150.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvgvdvelitsinvendtfiernftpqeieycsaqpsvqssfagtwsakeavfksllkdi
eivrtapavelhgnakkaaeeagvtdvkvsishddlqavavavstk

SCOPe Domain Coordinates for d2wasf_:

Click to download the PDB-style file with coordinates for d2wasf_.
(The format of our PDB-style files is described here.)

Timeline for d2wasf_: